DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phk-3 and EbpIII

DIOPT Version :9

Sequence 1:NP_001286870.1 Gene:Phk-3 / 37997 FlyBaseID:FBgn0035089 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001286808.1 Gene:EbpIII / 49821 FlyBaseID:FBgn0011695 Length:126 Species:Drosophila melanogaster


Alignment Length:114 Identity:65/114 - (57%)
Similarity:81/114 - (71%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKASLALVFCVCVGLAAAAPEKTYTNKYDSVNVDEVLGNNRVLGNYLKCLMDKGPCTAEGRELKR 65
            ||..|||   |.:||...|.|..||.|||:::|||:|.::|:.|||.|||:|.|.||.||||||:
  Fly     1 MKMILAL---VVLGLVLVAAEDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDNGKCTPEGRELKK 62

  Fly    66 LLPDALHSDCSKCTEVQRKNSQKVINYLRANKAGEWKLLLNKYDPQGIY 114
            .|||||.::||||:|.||:|:.|||.|:..||..|||.|..||||..||
  Fly    63 SLPDALKTECSKCSEKQRQNTDKVIRYIIENKPEEWKQLQAKYDPDEIY 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phk-3NP_001286870.1 OS-D 24..115 CDD:281395 55/91 (60%)
EbpIIINP_001286808.1 OS-D 21..113 CDD:281395 55/91 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CRZI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27156
OrthoDB 1 1.010 - - D116230at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.