DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phk-3 and CG30172

DIOPT Version :9

Sequence 1:NP_001286870.1 Gene:Phk-3 / 37997 FlyBaseID:FBgn0035089 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001286811.1 Gene:CG30172 / 246496 FlyBaseID:FBgn0050172 Length:112 Species:Drosophila melanogaster


Alignment Length:106 Identity:29/106 - (27%)
Similarity:53/106 - (50%) Gaps:6/106 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SLALVFCVCVGLAAAAPEKTYTNKYDSVNVDEVLGNNRVLGNYLKCLMDKGPCTAEGRELKRLLP 68
            ||.:.|...:.|.:::.:.      |..|::::|.|..|:...:.|::.|..|...|.:||..||
  Fly    11 SLVVNFIFLIILISSSVQA------DERNINKLLNNQVVVSRQIMCILGKSECDQLGLQLKAALP 69

  Fly    69 DALHSDCSKCTEVQRKNSQKVINYLRANKAGEWKLLLNKYD 109
            :.:...|..|:..|.:.:||:..:|:......|.:||.|||
  Fly    70 EVITRKCRNCSPQQAQKAQKLTTFLQTRYPDVWAMLLRKYD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phk-3NP_001286870.1 OS-D 24..115 CDD:281395 25/86 (29%)
CG30172NP_001286811.1 OS-D 30..110 CDD:281395 23/79 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.