DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3776 and MBA1

DIOPT Version :9

Sequence 1:NP_001286868.1 Gene:CG3776 / 37996 FlyBaseID:FBgn0035088 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_009744.3 Gene:MBA1 / 852483 SGDID:S000000389 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:47/228 - (20%)
Similarity:80/228 - (35%) Gaps:85/228 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KKEQNARESLNRLPRLMDF-PEIVWPSALNSLKNWITIQFI------------------------ 95
            ||:::.::..|  ||.:.. .||..|||..:|.|......|                        
Yeast    42 KKDKSKQQDFN--PRHLGVAAEIFIPSAYKNLPNVFAHPLIVANALIRRLYTFGLNSVQVALFRF 104

  Fly    96 ---IRPYF--------------DSEFQLKDF--IYG-----AKQALQVVSSKLMGG--------D 128
               |:|.|              ::.|..|:.  |.|     .::||:..|.:|.|.        .
Yeast   105 QSGIKPSFLLWKNKAIETYINVNTSFAHKNLSDIKGLVSLWVQEALEARSRQLPGNATLDWQLIK 169

  Fly   129 LDSLDNLVSPEAI------AELRPVIQKLSMTQR--------RQLEIKESDI--YLSF------- 170
            .:::..|||.:.|      .|...::.|....||        ::.|..:.|:  |::|       
Yeast   170 FNAVPKLVSVQPIMIPGMPLEHLQLVYKFDTKQRLIKVNQQTKKTETLDRDVVDYIAFLCDATTN 234

  Fly   171 -PYQVGIMFDD-ANDKLQKRFVEITMV-FHVMR 200
             ...:|.:|:. .||||.|.:.:...| .|.|:
Yeast   235 DMILMGSLFESKPNDKLPKSYEDDAKVAIHRMK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3776NP_001286868.1 Tim44 101..>144 CDD:298851 13/63 (21%)
MBA1NP_009744.3 MBA1 51..278 CDD:254545 45/219 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.