DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3776 and Maip1

DIOPT Version :9

Sequence 1:NP_001286868.1 Gene:CG3776 / 37996 FlyBaseID:FBgn0035088 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001074650.1 Gene:Maip1 / 68115 MGIID:1915365 Length:291 Species:Mus musculus


Alignment Length:248 Identity:65/248 - (26%)
Similarity:103/248 - (41%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IRCLGMARISLMRLQPRPTVAASGGQEAGSISKPTQPVSRSFASLPQEQDKKEQNARESLNRLPR 70
            :|.....|..|.|::..|.:|          |.|..| |||:::  :||.::.|..|..      
Mouse    66 LRSWSSRRSLLGRVEHPPALA----------SLPASP-SRSYST--EEQPQQRQRTRMI------ 111

  Fly    71 LMDFPEIVWPSALNSLKNWITIQ---FIIRPYFDSEFQLKDFIYGAKQALQVVSSKLMGGDLDSL 132
            ::.|...:         ||:..:   |:|..|||.||.:.:|..|||||...||..|.....|.|
Mouse   112 ILGFSNPI---------NWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQAFAYVSKLLSQCKFDLL 167

  Fly   133 DNLVSPEAIAELRPVIQKLSMTQRRQLEIKESDIYLSFPYQVGIMFDDANDKLQKRFVEITMVFH 197
            :.||:.|.:..|:..:..||...:..|.....||..:....:.|.:|:..    ::||.|.|.|.
Mouse   168 EELVAKEVLQILKEKVTSLSDNHKNALAADIDDIVYTSTGDISIYYDEKG----RKFVNILMCFW 228

  Fly   198 VMRGL---SEMRERGEEIPWNMGTLPEYQDKVFICNYRFVKEFTAGHQSDWTV 247
            .:...   ||...........:|.......::...:|.|.:|||.|.:.|||:
Mouse   229 YLTSANIPSESLSGANVFQVKLGDQSVETKQLLSASYEFQREFTQGVKPDWTI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3776NP_001286868.1 Tim44 101..>144 CDD:298851 17/42 (40%)
Maip1NP_001074650.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837829
Domainoid 1 1.000 69 1.000 Domainoid score I9566
eggNOG 1 0.900 - - E1_28IWR
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5311
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006981
OrthoInspector 1 1.000 - - oto92982
orthoMCL 1 0.900 - - OOG6_108532
Panther 1 1.100 - - LDO PTHR13333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5779
SonicParanoid 1 1.000 - - X5880
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.