DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3776 and Y62E10A.20

DIOPT Version :9

Sequence 1:NP_001286868.1 Gene:CG3776 / 37996 FlyBaseID:FBgn0035088 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001041053.1 Gene:Y62E10A.20 / 4363066 WormBaseID:WBGene00044745 Length:220 Species:Caenorhabditis elegans


Alignment Length:255 Identity:56/255 - (21%)
Similarity:95/255 - (37%) Gaps:44/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIRCLGMARISLMRLQPRPTVAASGGQEAGSISKPTQPVSRSFASLPQEQDKKEQNARESLNRLP 69
            :::|....|    |:.||....||...|..: :.|....:||:                      
 Worm     1 MLKCSHAIR----RISPRNLCTASTSAEIAN-AVPLISNNRSY---------------------- 38

  Fly    70 RLMDFPEIVWPS-ALNSLKNWITIQFIIRPYFDSEFQLKDFIYGAKQALQVVSSKLMGGDLDSLD 133
             :.|.|::..|: .|:.....:..|......::..|.::..::||.:.:..:|..|.....|.::
 Worm    39 -VFDTPQVSVPTFELSRRVGNLFAQSFYTLCYEKSFTVESLVHGANKGIHSLSHFLADEKWDQME 102

  Fly   134 NLVSPEAIAELRPVIQKLSMTQRRQLEIKESDIYLSFPYQVGIMFDDANDKLQKRFVEI--TMVF 196
            ||...:|:..:|...:.||......|.....||.|||.:...|...|.......|.:.|  |:|.
 Worm   103 NLAVKDAVENMREARKGLSKQLENALRFSPDDILLSFLHSTVISGRDVLKLSSSRNIGIYFTVVS 167

  Fly   197 HVMRGLSEMRERGEEIPWN--MGTLP-EYQDKVFICNYRFVKEFTAGHQSDWTVNVANQF 253
            .|        ...|::|.|  :|.|. :|:..|.:||..|.:  .......|.|..||.|
 Worm   168 FV--------RLSEKVPENASIGELSGKYKSDVLVCNATFSR--VLNPLGVWKVTNANFF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3776NP_001286868.1 Tim44 101..>144 CDD:298851 9/42 (21%)
Y62E10A.20NP_001041053.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159722
Domainoid 1 1.000 41 1.000 Domainoid score I8509
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I4153
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108532
Panther 1 1.100 - - LDO PTHR13333
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.