DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3776 and CG9863

DIOPT Version :9

Sequence 1:NP_001286868.1 Gene:CG3776 / 37996 FlyBaseID:FBgn0035088 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_611780.3 Gene:CG9863 / 37694 FlyBaseID:FBgn0034846 Length:267 Species:Drosophila melanogaster


Alignment Length:112 Identity:27/112 - (24%)
Similarity:47/112 - (41%) Gaps:25/112 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QKLSMTQRRQLEIKESDIYLSFPYQVGIMFDDANDKLQKRFVEITMVFHVMRGLSEMRERGE-EI 212
            :|..|.||.|..:..|        |:...|:.:|.:|  ...||.:.|.:        |.|: :.
  Fly   174 EKEEMLQRIQSVLVNS--------QIDDKFEPSNCRL--AIAEIVLTFSM--------ELGDPQD 220

  Fly   213 PWNMGTLPEYQDKVFICNYRFVKEFTAGHQSDWTVNVANQFRAIDLI 259
            |.::.:  |.||..::.:...|:.|.....|..|:|:    |.||.:
  Fly   221 PRDIES--EDQDSGWLVDSYKVQRFKLISFSPKTLNL----RVIDFL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3776NP_001286868.1 Tim44 101..>144 CDD:298851
CG9863NP_611780.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056493at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.