DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3776 and CG30412

DIOPT Version :9

Sequence 1:NP_001286868.1 Gene:CG3776 / 37996 FlyBaseID:FBgn0035088 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_726305.1 Gene:CG30412 / 37691 FlyBaseID:FBgn0050412 Length:301 Species:Drosophila melanogaster


Alignment Length:309 Identity:58/309 - (18%)
Similarity:111/309 - (35%) Gaps:87/309 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HTLI--RCLGMARI--SLMRLQPRPTVAASGGQEAGSISKPTQPVSRSFASLPQEQD---KKEQN 60
            |.|:  :|.....:  .|:|...|...:....|.|.....|...:|.. ..|..|.|   .|:: 
  Fly     5 HRLLMDKCTRYGHVLRHLIRASRRTATSTGHHQSASGKDVPMVQISPG-KKLDIELDFFVAKDE- 67

  Fly    61 ARESLNRLPRLMDFPEIVW-PSALNSLKNWITIQFIIRPYFDSEFQLKDFIYGAKQALQVVSSKL 124
                    |..|..|.::: .|.|:.|...:.: ..::..:|.:|..:.||..:.||..|.:..:
  Fly    68 --------PHQMSLPTMIYFYSPLSRLTTKLAL-LRLKLLWDWDFSEQKFIENSSQAAAVFTDFV 123

  Fly   125 MGGDLDSLDNLVSPEAIAELR------PVIQKLSMTQRRQLEIKESDIYLSFPYQVGIM--FDDA 181
            ......:::...:|....:::      |...:|.|     :..::.....:.|.:|.::  :|  
  Fly   124 RRRRNRNVERCSTPMGFKQIKHDLLDDPPDWRLKM-----MRFEKEHFRRAIPLKVQLLRHYD-- 181

  Fly   182 NDKLQKRFVEITMVFHVMR---------GLSEMRERGEEIPWNMGTLPEYQD------------- 224
                 .||..:.:||..:|         .||||.|          .|.|:.|             
  Fly   182 -----HRFAFLDVVFVALRRSNDFRSPAELSEMTE----------LLKEFIDPAQLRVPHPLIFA 231

  Fly   225 KVFICNYRFVKEFTA-----GHQSD-------WTVNVANQFRAIDLINE 261
            :||:   ||.::::.     |:..|       |.|:.....| .|::|:
  Fly   232 EVFM---RFRRDYSVEPSRMGNVQDNSRCMGQWLVSTYKVVR-FDILNQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3776NP_001286868.1 Tim44 101..>144 CDD:298851 8/42 (19%)
CG30412NP_726305.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056493at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.