DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3776 and SPAC13G7.11

DIOPT Version :9

Sequence 1:NP_001286868.1 Gene:CG3776 / 37996 FlyBaseID:FBgn0035088 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_593713.1 Gene:SPAC13G7.11 / 2542838 PomBaseID:SPAC13G7.11 Length:269 Species:Schizosaccharomyces pombe


Alignment Length:159 Identity:35/159 - (22%)
Similarity:64/159 - (40%) Gaps:34/159 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NSLKNWITIQFIIRPYF-DSEFQLKDFIYGAKQALQVVSSKLMGGDLDSLDNLVS---------- 137
            |..||    ||:|:..| |.:|.:.:.|..|.:....|:..|...||..|:.|.:          
pombe    87 NLKKN----QFLIKRTFPDRDFSIAEIIQNALKLHSGVNKALANHDLQQLEELCTLRTAQILKQQ 147

  Fly   138 ----PEAIAELRPVIQ--KLSMTQRRQLEIKESDIYLSFPYQV----GIMFDDANDKLQKRFVEI 192
                |:.|.:|...|.  ||....|.|.::|..:.::....::    .:..|..:.|::|..:|.
pombe   148 ALNQPKCIWKLEKHISKPKLLNLSRAQADLKGEEFFVQAVVRLHTLQSLRTDKGSPKIEKPDIEN 212

  Fly   193 TMVFHVMRGLSEMRERGEEIPWNM-GTLP 220
            .::        :.|.....|.|.: |::|
pombe   213 VVI--------QQRSWTSPIRWQLWGSVP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3776NP_001286868.1 Tim44 101..>144 CDD:298851 12/56 (21%)
SPAC13G7.11NP_593713.1 MBA1 40..266 CDD:254545 35/159 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.