DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL19 and AT4G16030

DIOPT Version :10

Sequence 1:NP_476631.1 Gene:RpL19 / 37995 FlyBaseID:FBgn0285950 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_193338.2 Gene:AT4G16030 / 827287 AraportID:AT4G16030 Length:114 Species:Arabidopsis thaliana


Alignment Length:126 Identity:51/126 - (40%)
Similarity:73/126 - (57%) Gaps:19/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHL-YH 121
            |||.|      ||||.||.|:||....|..|:..:|  .:|.::|:|||||:..:||||:.: ||
plant     7 HSRSR------ARRKCRHTGYGKDTMEALRRIMKRL--TRRLKMLKRLLKKFCWNKKIDKLVYYH 63

  Fly   122 DLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATKKQ 182
            |::||.||.|:|||.||||.:||...|::.|          ..::|.|.:...|:.|:..|
plant    64 DMFMKVKGKVYKNKCVLMESMHKSSRERKFS----------GSEMRLALEPEGEKTASAPQ 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL19NP_476631.1 Ribosomal_L19e_E 4..165 CDD:238705 46/107 (43%)
AT4G16030NP_193338.2 Ribosomal_L19e <7..92 CDD:444771 45/92 (49%)

Return to query results.
Submit another query.