DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL19 and AT4G16030

DIOPT Version :9

Sequence 1:NP_476631.1 Gene:RpL19 / 37995 FlyBaseID:FBgn0285950 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_193338.2 Gene:AT4G16030 / 827287 AraportID:AT4G16030 Length:114 Species:Arabidopsis thaliana


Alignment Length:126 Identity:51/126 - (40%)
Similarity:73/126 - (57%) Gaps:19/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHL-YH 121
            |||.|      ||||.||.|:||....|..|:..:|  .:|.::|:|||||:..:||||:.: ||
plant     7 HSRSR------ARRKCRHTGYGKDTMEALRRIMKRL--TRRLKMLKRLLKKFCWNKKIDKLVYYH 63

  Fly   122 DLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATKKQ 182
            |::||.||.|:|||.||||.:||...|::.|          ..::|.|.:...|:.|:..|
plant    64 DMFMKVKGKVYKNKCVLMESMHKSSRERKFS----------GSEMRLALEPEGEKTASAPQ 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL19NP_476631.1 Ribosomal_L19e_E 4..165 CDD:238705 46/107 (43%)
AT4G16030NP_193338.2 Ribosomal_L19e <7..92 CDD:412243 45/92 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437042at2759
OrthoFinder 1 1.000 - - FOG0001969
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.