DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL19 and rpl19

DIOPT Version :9

Sequence 1:NP_476631.1 Gene:RpL19 / 37995 FlyBaseID:FBgn0285950 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001005122.1 Gene:rpl19 / 448704 XenbaseID:XB-GENE-1008915 Length:197 Species:Xenopus tropicalis


Alignment Length:197 Identity:148/197 - (75%)
Similarity:169/197 - (85%) Gaps:0/197 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRK 65
            ||.|:||||||:||||||||||||||||.|||||.||||.||||:||||||:|||.||||.|.||
 Frog     1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIRKPVTVHSRARCRK 65

  Fly    66 NTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGN 130
            ||.|||||||.|.||||||||||||.||.||:|.|:|||||::||:|||||||:||.||:|.|||
 Frog    66 NTLARRKGRHMGIGKRKGTANARMPEKLAWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGN 130

  Fly   131 VFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATKKQELIALHAKEDEIA 195
            ||||||:|||:|||.||:|.|.|:|||||||||.|.:|||||||||:..||:|:|...:||:|..
 Frog   131 VFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEESG 195

  Fly   196 AK 197
            .|
 Frog   196 KK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL19NP_476631.1 Ribosomal_L19e_E 4..165 CDD:238705 128/160 (80%)
rpl19NP_001005122.1 Ribosomal_L19e_E 4..167 CDD:238705 129/162 (80%)
DUF1682 <144..192 CDD:369610 30/47 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 242 1.000 Domainoid score I2192
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68105
Inparanoid 1 1.050 305 1.000 Inparanoid score I2609
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437042at2759
OrthoFinder 1 1.000 - - FOG0001969
OrthoInspector 1 1.000 - - oto105297
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.