DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL19 and RGD1562420

DIOPT Version :9

Sequence 1:NP_476631.1 Gene:RpL19 / 37995 FlyBaseID:FBgn0285950 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_038968974.1 Gene:RGD1562420 / 314532 RGDID:1562420 Length:265 Species:Rattus norvegicus


Alignment Length:190 Identity:132/190 - (69%)
Similarity:154/190 - (81%) Gaps:7/190 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTE 68
            |:||||||:|||.|||||||:||:|.|||||.||||.|||||||||||:|.|.||.  |.||||.
  Rat    80 LRLQKRLASSVLCCGKKKVWMDPHETNEIANANSRQQIRKLIKDGLIIRKHVPVHC--RCRKNTL 142

  Fly    69 ARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFK 133
            |||||||.|..|.|||||||||.|:.|     :|||||::||:|||||.|:||.|.:|.||||||
  Rat   143 ARRKGRHMGIEKWKGTANARMPEKVTW-----ILRRLLRRYRESKKIDCHIYHSLCLKVKGNVFK 202

  Fly   134 NKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATKKQELIALHAKEDE 193
            |||:|||:|||.||:|.|.|:|||||||||.|.:|||||||||:..||:|:|...:||:|
  Rat   203 NKRILMEHIHKLKADKTRKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL19NP_476631.1 Ribosomal_L19e_E 4..165 CDD:238705 115/160 (72%)
RGD1562420XP_038968974.1 Ribosomal_L19e_E 83..236 CDD:238705 114/159 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I2574
OMA 1 1.010 - - QHG62202
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001969
OrthoInspector 1 1.000 - - otm46311
orthoMCL 1 0.900 - - OOG6_100773
Panther 1 1.100 - - O PTHR10722
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X979
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.