DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL19 and Cnbd2

DIOPT Version :9

Sequence 1:NP_476631.1 Gene:RpL19 / 37995 FlyBaseID:FBgn0285950 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001291297.1 Gene:Cnbd2 / 296311 RGDID:1311678 Length:712 Species:Rattus norvegicus


Alignment Length:218 Identity:41/218 - (18%)
Similarity:65/218 - (29%) Gaps:79/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LIIKKPVVVHSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQR-----VLRRLLKK 108
            |:..||:.||       |.|...|.|...|..:..........|||.:|..|     ...|.:.|
  Rat   441 LLDHKPLRVH-------NNEMSPKERFKEFQIKSYPLQDFTYLKLLRLQEAREQPAMTFHRKINK 498

  Fly   109 YRDS------KKIDRHLYHD--------------------LYMKC----KGNVFKNKRVLMEYIH 143
            ..:|      .|:.....|.                    :|||.    :|:|..|.:..:..||
  Rat   499 AENSLPKLLGPKVKSRYGHSVKCSMVHTKYGELPKEAIVGVYMKVHLTEEGDVVGNHQAFLPEIH 563

  Fly   144 KK--------------KAEKQRSKMLAD-QAEARRQKVREARKRREERIAT-------------- 179
            :.              :..|::...|.| :.:|:..|:.......||...:              
  Rat   564 RDPRSFILLSLGTELIRVRKEKFYDLVDAETKAKIMKMDVDYPSDEELCQSFLSENDWSIFRRDL 628

  Fly   180 --------KKQELIALHAKEDEI 194
                    ||:..|.:..|:.||
  Rat   629 LRLLVEPLKKKPFIPIQTKKKEI 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL19NP_476631.1 Ribosomal_L19e_E 4..165 CDD:238705 32/165 (19%)
Cnbd2NP_001291297.1 CAP_ED 250..349 CDD:237999
Crp 253..>348 CDD:223736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.