DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL19 and rpl1901

DIOPT Version :9

Sequence 1:NP_476631.1 Gene:RpL19 / 37995 FlyBaseID:FBgn0285950 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_596715.1 Gene:rpl1901 / 2540870 PomBaseID:SPBC56F2.02 Length:193 Species:Schizosaccharomyces pombe


Alignment Length:193 Identity:115/193 - (59%)
Similarity:159/193 - (82%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRK 65
            |::|:.|||||||||:|||:|||:|||||:||:|.|||||:||||||||:|:||.::|||:|:||
pombe     1 MANLRTQKRLAASVLKCGKRKVWMDPNEISEISNANSRQNVRKLIKDGLVIRKPNLMHSRFRIRK 65

  Fly    66 NTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGN 130
            ...|:|.|||.|:|||||||.||||:.::||:|||||||||:|||:|.|||:||||.||::.|||
pombe    66 THAAKRLGRHTGYGKRKGTAEARMPSAVVWMRRQRVLRRLLRKYRESGKIDKHLYHTLYLEAKGN 130

  Fly   131 VFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATKKQELIALHAKEDE 193
            .||:||.|:|:|.:.|||..|:|::.:|.:|||.:.:.||:||.:.:..|:::|.....|.:|
pombe   131 TFKHKRALIEHIQRAKAEANRTKLIQEQQDARRARAKAARQRRAKAVEEKREQLYTAAEKIEE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL19NP_476631.1 Ribosomal_L19e_E 4..165 CDD:238705 106/160 (66%)
rpl1901NP_596715.1 Ribosomal_L19e_E 4..160 CDD:238705 103/155 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 216 1.000 Domainoid score I576
eggNOG 1 0.900 - - E1_COG2147
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68105
Inparanoid 1 1.050 253 1.000 Inparanoid score I771
OMA 1 1.010 - - QHG62202
OrthoFinder 1 1.000 - - FOG0001969
OrthoInspector 1 1.000 - - otm47401
orthoMCL 1 0.900 - - OOG6_100773
Panther 1 1.100 - - O PTHR10722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1113
SonicParanoid 1 1.000 - - X979
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.