DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL19 and Rpl19

DIOPT Version :9

Sequence 1:NP_476631.1 Gene:RpL19 / 37995 FlyBaseID:FBgn0285950 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_033104.2 Gene:Rpl19 / 19921 MGIID:98020 Length:196 Species:Mus musculus


Alignment Length:193 Identity:147/193 - (76%)
Similarity:168/193 - (87%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRK 65
            ||.|:||||||:||||||||||||||||.|||||.||||.|||||||||||:|||.||||.|.||
Mouse     1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRK 65

  Fly    66 NTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGN 130
            ||.|||||||.|.||||||||||||.|:.||:|.|:|||||::||:|||||||:||.||:|.|||
Mouse    66 NTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGN 130

  Fly   131 VFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATKKQELIALHAKEDE 193
            ||||||:|||:|||.||:|.|.|:|||||||||.|.:|||||||||:..||:|:|...:||:|
Mouse   131 VFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL19NP_476631.1 Ribosomal_L19e_E 4..165 CDD:238705 128/160 (80%)
Rpl19NP_033104.2 Ribosomal_L19e_E 4..167 CDD:238705 129/162 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..176 15/18 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850047
Domainoid 1 1.000 241 1.000 Domainoid score I2246
eggNOG 1 0.900 - - E1_COG2147
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68105
Inparanoid 1 1.050 304 1.000 Inparanoid score I2635
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62202
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001969
OrthoInspector 1 1.000 - - oto95112
orthoMCL 1 0.900 - - OOG6_100773
Panther 1 1.100 - - LDO PTHR10722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1113
SonicParanoid 1 1.000 - - X979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.