DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL19 and LOC100364265

DIOPT Version :9

Sequence 1:NP_476631.1 Gene:RpL19 / 37995 FlyBaseID:FBgn0285950 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_003749939.1 Gene:LOC100364265 / 100364265 RGDID:2321393 Length:632 Species:Rattus norvegicus


Alignment Length:127 Identity:71/127 - (55%)
Similarity:93/127 - (73%) Gaps:0/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GLIIKKPVVVHSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDS 112
            ||||:|||.|||...:|:......:|:..|..:.:|||||||..||.||:|.|:|.|||::||:|
  Rat   503 GLIIRKPVTVHSPGSLREKHLGLMEGQAYGHREEEGTANARMSEKLTWMRRMRILHRLLRRYRES 567

  Fly   113 KKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRRE 174
            |||||.:||.|.:|.||||||||..|:::|||.||::...|:||||.||||.|.::||.|||
  Rat   568 KKIDRRMYHSLDLKVKGNVFKNKWSLVDHIHKLKADRAPKKLLADQTEARRSKTKKARMRRE 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL19NP_476631.1 Ribosomal_L19e_E 4..165 CDD:238705 65/116 (56%)
LOC100364265XP_003749939.1 Mt_ATP-synt_D <315..377 CDD:283519
GrpE 318..>448 CDD:295646
Ribosomal_L19e <503..622 CDD:294162 66/118 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353741
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437042at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100773
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.