DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2765 and Mid1ip1

DIOPT Version :9

Sequence 1:NP_001097451.1 Gene:CG2765 / 37994 FlyBaseID:FBgn0035087 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001160107.1 Gene:Mid1ip1 / 68041 MGIID:1915291 Length:182 Species:Mus musculus


Alignment Length:245 Identity:48/245 - (19%)
Similarity:85/245 - (34%) Gaps:90/245 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKFVKTVNIMDDTILVPCRLMDRQIGDSTDI----IPATGKDSTANQLTQTSSAHGKRGAAHSK 61
            |.:|:..||.||.|::||..|.|..:.: .:|    :...|......:.|..:.:.|      |.
Mouse    18 MNRFIGAVNNMDQTVMVPSLLRDVPLSE-PEIDEVSVEVGGSGGCLEERTTPAPSPG------SA 75

  Fly    62 NVQDFLSASELFNLYNMLNSLKKDLLWTANQEDDDQQHSEQQLNASTSSTSSCNPSESKTEFNSG 126
            |...|..:.::::.|.:|.|::.|:.|....:                                 
Mouse    76 NESFFAPSRDMYSHYVLLKSIRNDIEWGVLHQ--------------------------------- 107

  Fly   127 SPSTTASGSVKGHVRRTSTASMMSTNSVSNMSDSDSDISQENDSGLESDGNKSDNAQSSDGSDIV 191
             ||:..:||.:                 |.....|..:      ||       .:.:|:|..:  
Mouse   108 -PSSPPAGSEE-----------------STWKPKDILV------GL-------SHLESADAGE-- 139

  Fly   192 DVAKSKPGSGDKATELAKRCRRHLNGLYQCLEQMTEAANYLTARYQSDIG 241
                         .:|.::...||.||:..|.::|..||.||.||:.:||
Mouse   140 -------------EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2765NP_001097451.1 Spot_14 <187..241 CDD:284493 13/53 (25%)
Mid1ip1NP_001160107.1 Spot_14 3..176 CDD:311192 46/243 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..75 3/25 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850222
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E02X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5310
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326063at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109013
Panther 1 1.100 - - LDO PTHR14315
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.850

Return to query results.
Submit another query.