DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2765 and MID1IP1

DIOPT Version :9

Sequence 1:NP_001097451.1 Gene:CG2765 / 37994 FlyBaseID:FBgn0035087 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001092260.1 Gene:MID1IP1 / 58526 HGNCID:20715 Length:183 Species:Homo sapiens


Alignment Length:246 Identity:49/246 - (19%)
Similarity:83/246 - (33%) Gaps:91/246 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKFVKTVNIMDDTILVPCRLMDRQIGD---STDI-IPATGKDSTANQLTQTSSAHGKRGAAHSK 61
            |.:|:..||.||.|::||..|.|..:.|   ..|: :...|......:.|......|      |.
Human    18 MNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSG------SA 76

  Fly    62 NVQDFLSASELFNLYNMLNSLKKDLLWTANQEDDDQQHSEQQLNASTSSTSSCNPSESKTEFNSG 126
            |...|..:.::::.|.:|.|::.|:.|....:......||:                       |
Human    77 NGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEE-----------------------G 118

  Fly   127 SPSTTASGSVK-GHVRRTSTASMMSTNSVSNMSDSDSDISQENDSGLESDGNKSDNAQSSDGSDI 190
            |...:....|. ||:                                             :|:| 
Human   119 SAWKSKDILVDLGHL---------------------------------------------EGAD- 137

  Fly   191 VDVAKSKPGSGDKATELAKRCRRHLNGLYQCLEQMTEAANYLTARYQSDIG 241
                     :|::  :|.::...||.||:..|.::|..||.||.||:.:||
Human   138 ---------AGEE--DLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2765NP_001097451.1 Spot_14 <187..241 CDD:284493 16/53 (30%)
MID1IP1NP_001092260.1 Spot_14 3..177 CDD:399817 47/244 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159853
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E02X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5315
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326063at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109013
Panther 1 1.100 - - LDO PTHR14315
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.