DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2765 and thrsp

DIOPT Version :9

Sequence 1:NP_001097451.1 Gene:CG2765 / 37994 FlyBaseID:FBgn0035087 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001124261.1 Gene:thrsp / 568167 ZFINID:ZDB-GENE-081022-19 Length:134 Species:Danio rerio


Alignment Length:100 Identity:20/100 - (20%)
Similarity:37/100 - (37%) Gaps:33/100 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKFVKTVNIMDDTILVPCRLMDRQIGDSTDIIPATGKDSTANQLTQTSSAHGKRGAAHSKNVQD 65
            ::::..:|:.|:.|||:|..|.|....|      |.|  :|.|.:                    
Zfish    17 LQRYSTSVHNMEQTILLPSLLRDIPYND------APG--ATDNSM-------------------- 53

  Fly    66 FLSASELFNLYNMLNSLKKDLLWTANQEDDDQQHS 100
                 :|:..|.||..:|..:.......:|.:.|:
Zfish    54 -----DLYENYLMLKDIKNMVESGLVPHEDGEYHT 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2765NP_001097451.1 Spot_14 <187..241 CDD:284493
thrspNP_001124261.1 Spot_14 18..131 CDD:284493 20/98 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5362
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326063at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14315
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.090

Return to query results.
Submit another query.