powered by:
Protein Alignment CG2765 and thrsp
DIOPT Version :9
Sequence 1: | NP_001097451.1 |
Gene: | CG2765 / 37994 |
FlyBaseID: | FBgn0035087 |
Length: | 243 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001124261.1 |
Gene: | thrsp / 568167 |
ZFINID: | ZDB-GENE-081022-19 |
Length: | 134 |
Species: | Danio rerio |
Alignment Length: | 100 |
Identity: | 20/100 - (20%) |
Similarity: | 37/100 - (37%) |
Gaps: | 33/100 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEKFVKTVNIMDDTILVPCRLMDRQIGDSTDIIPATGKDSTANQLTQTSSAHGKRGAAHSKNVQD 65
::::..:|:.|:.|||:|..|.|....| |.| :|.|.:
Zfish 17 LQRYSTSVHNMEQTILLPSLLRDIPYND------APG--ATDNSM-------------------- 53
Fly 66 FLSASELFNLYNMLNSLKKDLLWTANQEDDDQQHS 100
:|:..|.||..:|..:.......:|.:.|:
Zfish 54 -----DLYENYLMLKDIKNMVESGLVPHEDGEYHT 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2765 | NP_001097451.1 |
Spot_14 |
<187..241 |
CDD:284493 |
|
thrsp | NP_001124261.1 |
Spot_14 |
18..131 |
CDD:284493 |
20/98 (20%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170596107 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
65 |
1.000 |
Inparanoid score |
I5362 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1326063at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR14315 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.090 |
|
Return to query results.
Submit another query.