DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2765 and Mid1ip1

DIOPT Version :9

Sequence 1:NP_001097451.1 Gene:CG2765 / 37994 FlyBaseID:FBgn0035087 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_996833.1 Gene:Mid1ip1 / 404280 RGDID:1303258 Length:183 Species:Rattus norvegicus


Alignment Length:245 Identity:49/245 - (20%)
Similarity:86/245 - (35%) Gaps:89/245 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKFVKTVNIMDDTILVPCRLMDRQIG----DSTDIIPATGKDSTANQLTQTSSAHGKRGAAHSK 61
            |.:|:..||.||.|::||..|.|..:.    |:...:...|..|...:.|..:.:.|      |.
  Rat    18 MNRFIGAVNNMDQTVMVPSLLRDVPLSEPDLDNEVSVEVGGSGSCLEERTTPAPSPG------SA 76

  Fly    62 NVQDFLSASELFNLYNMLNSLKKDLLWTANQEDDDQQHSEQQLNASTSSTSSCNPSESKTEFNSG 126
            |...|..:.::::.|.:|.|::.|:.|....:                                 
  Rat    77 NGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQ--------------------------------- 108

  Fly   127 SPSTTASGSVKGHVRRTSTASMMSTNSVSNMSDSDSDISQENDSGLESDGNKSDNAQSSDGSDIV 191
             ||:..:||.:|        :....:.:..:|..:|     .|:|.|                  
  Rat   109 -PSSPPAGSEEG--------TWKPKDILVGLSHLES-----TDAGEE------------------ 141

  Fly   192 DVAKSKPGSGDKATELAKRCRRHLNGLYQCLEQMTEAANYLTARYQSDIG 241
                          :|.::...||.||:..|.::|..||.||.||:.:||
  Rat   142 --------------DLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2765NP_001097451.1 Spot_14 <187..241 CDD:284493 13/53 (25%)
Mid1ip1NP_996833.1 Spot_14 3..177 CDD:284493 47/243 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..77 5/31 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E02X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5203
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326063at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109013
Panther 1 1.100 - - LDO PTHR14315
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.850

Return to query results.
Submit another query.