DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2765 and mid1ip1b

DIOPT Version :9

Sequence 1:NP_001097451.1 Gene:CG2765 / 37994 FlyBaseID:FBgn0035087 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_957126.1 Gene:mid1ip1b / 393805 ZFINID:ZDB-GENE-040426-1720 Length:146 Species:Danio rerio


Alignment Length:241 Identity:43/241 - (17%)
Similarity:73/241 - (30%) Gaps:117/241 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKFVKTVNIMDDTILVPCRLMDRQIGDSTDIIPATGKDSTANQLTQTSSAHGKRGAAHSKNVQD 65
            |.:|:..||.||.|::||..|.|         :|...::                    .|.|..
Zfish    17 MNRFIGAVNNMDQTVMVPSLLRD---------VPLDQEE--------------------EKEVTS 52

  Fly    66 FLSASELFNLYNMLNSLKKDLLWTANQEDDDQQHSEQQLNASTSSTSSCNPSESKTEFNSGSPST 130
            | ...:::..|.:|.|::.|:.|                                          
Zfish    53 F-QDGDMYGSYVLLKSIRNDIEW------------------------------------------ 74

  Fly   131 TASGSVKGHVRRTSTASMMSTNSVSNMSDSDSDISQENDSGLESDGNKSDNAQSSDGSDIVDVAK 195
               |.::...||.....:.:|:                                      ::|::
Zfish    75 ---GVLQAEERRKEKHGVTTTS--------------------------------------LEVSR 98

  Fly   196 SKPGSGDKATELAKRCRRHLNGLYQCLEQMTEAANYLTARYQSDIG 241
            .:|...|    |.|....||:||:..|.::|..||.||.||:.:||
Zfish    99 IEPNDKD----LEKLFHYHLSGLHTVLAKLTRKANTLTNRYKQEIG 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2765NP_001097451.1 Spot_14 <187..241 CDD:284493 17/53 (32%)
mid1ip1bNP_957126.1 Spot_14 2..140 CDD:284493 41/239 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E02X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5362
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326063at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109013
Panther 1 1.100 - - LDO PTHR14315
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.