DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2765 and mid1ip1a

DIOPT Version :9

Sequence 1:NP_001097451.1 Gene:CG2765 / 37994 FlyBaseID:FBgn0035087 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_571410.1 Gene:mid1ip1a / 30600 ZFINID:ZDB-GENE-990415-81 Length:152 Species:Danio rerio


Alignment Length:241 Identity:43/241 - (17%)
Similarity:77/241 - (31%) Gaps:111/241 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKFVKTVNIMDDTILVPCRLMDRQIGDSTDIIPATGKDSTANQLTQTSSAHGKRGAAHSKNVQD 65
            |.:|:..||.||.|::||..|.|         :| ..::....:||....::.:...|       
Zfish    17 MNRFLGAVNNMDQTVMVPSLLRD---------VP-LDQEKEQQKLTNDPGSYLREAEA------- 64

  Fly    66 FLSASELFNLYNMLNSLKKDLLWTANQEDDDQQHSEQQLNASTSSTSSCNPSESKTEFNSGSPST 130
                 ::::.|:.|.|::.::.|...:.:|.::..:         ||:..|..::.|        
Zfish    65 -----DMYSYYSQLKSIRNNIEWGVIRSEDQRRKKD---------TSASEPVRTEEE-------- 107

  Fly   131 TASGSVKGHVRRTSTASMMSTNSVSNMSDSDSDISQENDSGLESDGNKSDNAQSSDGSDIVDVAK 195
                                         ||.|:.|                             
Zfish   108 -----------------------------SDMDLEQ----------------------------- 114

  Fly   196 SKPGSGDKATELAKRCRRHLNGLYQCLEQMTEAANYLTARYQSDIG 241
                          ..:.||.||:..|.|:|..||.||.||:.:||
Zfish   115 --------------LLQFHLKGLHGVLSQLTSQANNLTNRYKQEIG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2765NP_001097451.1 Spot_14 <187..241 CDD:284493 13/53 (25%)
mid1ip1aNP_571410.1 Spot_14 2..146 CDD:284493 41/239 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..109 5/67 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5362
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326063at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109013
Panther 1 1.100 - - O PTHR14315
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.