DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and Dnajc30

DIOPT Version :9

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_079638.2 Gene:Dnajc30 / 66114 MGIID:1913364 Length:219 Species:Mus musculus


Alignment Length:73 Identity:30/73 - (41%)
Similarity:39/73 - (53%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNH- 68
            ||.|.:...|....||:||.:.:..:|||:||.. |||.|||..:.:||.||.....|..||.. 
Mouse    44 YELLGVPSTATQAQIKAAYYRQSFLYHPDRNPGS-AEAAERFTRVSEAYLVLGSTILRRKYDRGL 107

  Fly    69 -REQILRG 75
             .:|.|||
Mouse   108 LSDQDLRG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 24/60 (40%)
ZUO1 19..>252 CDD:227594 26/59 (44%)
zf-C2H2_jaz 313..337 CDD:288983
C2H2 Zn finger 315..337 CDD:275371
Dnajc30NP_079638.2 DnaJ 43..104 CDD:278647 24/60 (40%)
DnaJ 44..>105 CDD:223560 25/61 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..148 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847140
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.