DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and CG17187

DIOPT Version :9

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster


Alignment Length:427 Identity:87/427 - (20%)
Similarity:145/427 - (33%) Gaps:151/427 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNHR 69
            |:.|.:...::..:|:.||||.||..|||||||. .:|.|||..:.:|.|:|:|...|:.||   
  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDN-PKAVERFHELSKALEILTDESARAAYD--- 72

  Fly    70 EQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDKDDRLGMA 134
             ::|:.|.:                                    .::.|..|:...:..:|.: 
  Fly    73 -KVLKAKKA------------------------------------AELRSRQLDGKRQKLKLEL- 99

  Fly   135 PDFGHSNSSYEDVVGPFYAFWQAYSTRKTYDWLCPYDVREIKERFILRKVEKEMKKIVQAARKER 199
                                                   |.:||..|.|:.|.......|   :.
  Fly   100 ---------------------------------------EERERAALHKLAKSQPYSTVA---KS 122

  Fly   200 NEEVRNLVNFVRKRDPRVQAYRRMLEERVEANRLKQEEKR--KEQLRKRQEELAAVRKNNVFNEG 262
            :|||.:         .:::..||      |.:||.:||:|  :||.|:              |..
  Fly   123 DEEVLH---------EQIERLRR------EGSRLLEEEQRAMQEQFRR--------------NHA 158

  Fly   263 YEEQLKQLEQQYDS---------KSEDYTDEDENDDDGEDFDHEGGQEAEEYEVEYVDDLYCVAC 318
            .:::|:|...|:||         |:|          .|:|:..   ||..:|..:|.|.:..|. 
  Fly   159 EQQKLQQQPVQFDSAQHRIKMKWKAE----------PGQDYTQ---QELLKYLKKYGDVVALVV- 209

  Fly   319 NKTFKNAKARANHEESKKHNENVDR-LCQEMEEEEDAFHNEPHEDSLMGVQESLEELQVSEDQIS 382
                 |:|.|..........|..|. |..|..:.....|.|       .|.....:.|.::...:
  Fly   210 -----NSKRRGRAMVELATREACDMVLAYEKGDPAKPLHFE-------WVTPPAADKQTTKSATT 262

  Fly   383 FDGVPSEEESSLAKRTKKNKKARKSAVKQAQAEGSDE 419
            .....|.:...|..|..:..:.||..::|...:...|
  Fly   263 GCSASSTDYEDLVMRKLRQAEERKRLIEQMMKDEEGE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 25/60 (42%)
ZUO1 19..>252 CDD:227594 51/234 (22%)
zf-C2H2_jaz 313..337 CDD:288983 4/23 (17%)
C2H2 Zn finger 315..337 CDD:275371 4/21 (19%)
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/60 (42%)
RRM_DNAJC17 175..247 CDD:240875 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.