DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and CG6693

DIOPT Version :9

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001262473.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster


Alignment Length:464 Identity:97/464 - (20%)
Similarity:166/464 - (35%) Gaps:193/464 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RCYYEELELQRNANDGDIKSAYRKMALRWHPDKNP-DRLAEAKERFQLIQQAYEVLSDPQERSWY 65
            |..|:.:||.|.|.:.::|.||.|::|..|||:.| ::.||:.|:|:::.:.|:||:|.|:|:.|
  Fly    14 RDVYKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVLTDTQKRALY 78

  Fly    66 DNHREQILRG--KNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDKD 128
            |.      :|  .:.|.:|:.|.                  .:..:::.:|..|..||:      
  Fly    79 DE------QGVIDDDDESESKLS------------------SWLELWSKIFKPITEEDI------ 113

  Fly   129 DRLGMAPDFGHSNSSYEDVVGPFYAFWQAYSTRKTYDWLCPYDVREIKERFILRKVEKEMKKIVQ 193
                         ::||                |.|       |....||..|:|.....|..: 
  Fly   114 -------------NNYE----------------KEY-------VESELERTDLKKAYLGGKGCI- 141

  Fly   194 AARKERNEEVRNLVNFVRKRD-PRVQAYRRMLEERVEANRLKQ-----EE---KRKEQLRKRQEE 249
                   ..:.|.|.|::..| ||:|   :::::.:.:..:.:     ||   |||::.:|...|
  Fly   142 -------NYLMNHVPFMKVEDEPRIQ---KIVQDMIASGEVPEYKIFTEEPAAKRKKRHQKYARE 196

  Fly   250 LAAVRKNNVFNEG--YEEQLKQLEQQYDSKSEDYTDEDENDDDGEDFDHEGGQEAEEYEVEYVDD 312
                     |.|.  .:|:||:.:::.|       |:|..|:.|                    |
  Fly   197 ---------FKEAKVIKERLKRRQKEKD-------DQDLADNGG--------------------D 225

  Fly   313 LYCVACNKTFKNAKARANHEESKKHNENVDRLCQEMEEEEDAFHNEPHEDSLMGVQESLEELQVS 377
            |.        :...||.|..|| .....:|||.::...|:|:                       
  Fly   226 LQ--------QMILARRNQRES-NFGSLMDRLMEKYGNEDDS----------------------- 258

  Fly   378 EDQISFDGVPSEEESSLAKRTKKNKKARKSAVKQAQAEGSDEPDEPIEKKAIKSESEDEDWSKGK 442
             |.:.|...           .||.||::|.|.||                      |.:....|.
  Fly   259 -DTVDFSAF-----------EKKKKKSKKPAAKQ----------------------ETKPKLNGV 289

  Fly   443 KASKKSKSK 451
            ||.:..|.|
  Fly   290 KAGRVEKGK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 24/63 (38%)
ZUO1 19..>252 CDD:227594 53/244 (22%)
zf-C2H2_jaz 313..337 CDD:288983 6/23 (26%)
C2H2 Zn finger 315..337 CDD:275371 5/21 (24%)
CG6693NP_001262473.1 DnaJ 15..79 CDD:278647 24/63 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.