powered by:
Protein Alignment CG2790 and Dnajc5g
DIOPT Version :9
Sequence 1: | NP_611986.2 |
Gene: | CG2790 / 37992 |
FlyBaseID: | FBgn0027599 |
Length: | 540 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017449734.1 |
Gene: | Dnajc5g / 366567 |
RGDID: | 1307426 |
Length: | 186 |
Species: | Rattus norvegicus |
Alignment Length: | 64 |
Identity: | 31/64 - (48%) |
Similarity: | 44/64 - (68%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNH 68
|..|||::.|...:||.||||:||::||||||.. ::|.|.|:.|..|:.||:||.::..||.|
Rat 19 YAVLELKKGAQPEEIKKAYRKLALQYHPDKNPGN-SQAAEFFKDINAAHAVLTDPTKKKIYDRH 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166350652 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.