DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and CG8531

DIOPT Version :10

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:73 Identity:34/73 - (46%)
Similarity:46/73 - (63%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYEELELQRNANDGDIKSAYRKMALRWHPDK--NPDRLAEAKERFQLIQQAYEVLSDPQERSWYD 66
            ||..|.|.|:|....|.:||||.:..:||||  :||....|:..|...::|||||||||:|:.||
  Fly    16 YYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIYD 80

  Fly    67 NHREQILR 74
            :..|:.||
  Fly    81 SVGEKGLR 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 terminal_TopJ 2..>154 CDD:468284 34/73 (47%)
PRK10767 2..>66 CDD:236757 29/63 (46%)
PRK12704 170..>272 CDD:237177
PTZ00108 <182..437 CDD:240271
zf-C2H2_jaz 313..337 CDD:432381
C2H2 Zn finger 315..337 CDD:275371
CG8531NP_610945.1 DnaJ 15..>123 CDD:440252 34/73 (47%)
DnaJ-like_C11_C 400..538 CDD:463378
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.