DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and CG7872

DIOPT Version :9

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster


Alignment Length:242 Identity:56/242 - (23%)
Similarity:93/242 - (38%) Gaps:86/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPD--KNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDN 67
            |:.|.:.|.::..:|..|||::|.|:|||  :..:..|.|:.:|:|:..|||:|.|.:.|:.|| 
  Fly    33 YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYD- 96

  Fly    68 HREQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDKDDRLG 132
               .:|...::.||.                       :||.|                   |..
  Fly    97 ---YMLDNPDAYYAH-----------------------YYRYY-------------------RRR 116

  Fly   133 MAPDFGHSNSSYEDV------------VGPFYAFWQAYSTRKTYDWLCP---YDVREIKERFILR 182
            :||..        ||            |..:|:.||.|.:...|....|   ....||....|..
  Fly   117 VAPKV--------DVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYRNQALEIARDEIQE 173

  Fly   183 KVEKEMKKIVQAARKERNEEVRNLVNFVRKRDPRVQAYRRMLEERVE 229
            |::|:.|.     |..:|::          ||...:..||::||:::
  Fly   174 KIQKKGKN-----RMSKNDQ----------RDELERIIRRVIEEKMD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 22/62 (35%)
ZUO1 19..>252 CDD:227594 53/228 (23%)
zf-C2H2_jaz 313..337 CDD:288983
C2H2 Zn finger 315..337 CDD:275371
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 22/62 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.