powered by:
Protein Alignment CG2790 and dnajc3a
DIOPT Version :9
Sequence 1: | NP_611986.2 |
Gene: | CG2790 / 37992 |
FlyBaseID: | FBgn0027599 |
Length: | 540 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_955904.2 |
Gene: | dnajc3a / 322544 |
ZFINID: | ZDB-GENE-030131-1264 |
Length: | 504 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 29/67 - (43%) |
Similarity: | 45/67 - (67%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 RCYYEELELQRNANDGDIKSAYRKMALRWHPD--KNPDRLAEAKERFQLIQQAYEVLSDPQERSW 64
|.||:.|.::|.|...:|..||||:|.:|||| ::.:...:|:::|..|.||.|||:||:.||.
Zfish 393 RDYYKILGVKRTAQKKEILKAYRKLAQQWHPDNFQDAEEKKKAEKKFIDIAQAKEVLTDPEMRSK 457
Fly 65 YD 66
:|
Zfish 458 FD 459
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170592355 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.