DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2790 and dnajc3a

DIOPT Version :9

Sequence 1:	NP_611986.2	Gene:	CG2790 / 37992	FlyBaseID:	FBgn0027599	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_955904.2	Gene:	dnajc3a / 322544	ZFINID:	ZDB-GENE-030131-1264	Length:	504	Species:	Danio rerio

Alignment Length:	67	Identity:	29/67 - (43%)
Similarity:	45/67 - (67%)	Gaps:	2/67 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 RCYYEELELQRNANDGDIKSAYRKMALRWHPD--KNPDRLAEAKERFQLIQQAYEVLSDPQERSW 64
            |.||:.|.::|.|...:|..||||:|.:||||  ::.:...:|:::|..|.||.|||:||:.||.
Zfish   393 RDYYKILGVKRTAQKKEILKAYRKLAQQWHPDNFQDAEEKKKAEKKFIDIAQAKEVLTDPEMRSK 457

  Fly    65 YD 66
            :|
Zfish   458 FD 459

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2790	NP_611986.2	DnaJ	3..66	CDD:278647	27/64 (42%)
		ZUO1	19..>252	CDD:227594	23/50 (46%)
		zf-C2H2_jaz	313..337	CDD:288983
		C2H2 Zn finger	315..337	CDD:275371
dnajc3a	NP_955904.2	TPR repeat	37..65	CDD:276809
		TPR_11	38..102	CDD:290150
		TPR repeat	70..100	CDD:276809
		TPR_11	73..136	CDD:290150
		TPR_1	73..104	CDD:278916
		TPR repeat	105..133	CDD:276809
		TPR repeat	157..182	CDD:276809
		TPR_11	194..252	CDD:290150
		TPR repeat	221..251	CDD:276809
		TPR repeat	256..281	CDD:276809
		LcrH_SycD	262..389	CDD:274197
		TPR repeat	301..335	CDD:276809
		TPR repeat	340..368	CDD:276809
		TPR repeat	374..397	CDD:276809	2/3 (67%)
		DnaJ	391..>502	CDD:223560	29/67 (43%)
		DnaJ	394..459	CDD:278647	27/64 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170592355
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930