DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and dnj-7

DIOPT Version :9

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_509209.1 Gene:dnj-7 / 180983 WormBaseID:WBGene00001025 Length:491 Species:Caenorhabditis elegans


Alignment Length:114 Identity:35/114 - (30%)
Similarity:55/114 - (48%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RCYYEELELQRNANDGDIKSAYRKMALRWHPD--KNPDRLAEAKERFQLIQQAYEVLSDPQERSW 64
            |.||:.|.::|||:..:|..||||:|.:||||  .:.:...:|:::|..|..|.|||.|.::|..
 Worm   378 RDYYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEEEKKKAEKKFIDIAAAKEVLQDEEKRRQ 442

  Fly    65 YDN-------HREQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGF 106
            :|.       ..::...|.:..:.......|..|     .|.|..||.|
 Worm   443 FDQGVDPLDPEAQRQGGGHHGGFGHGFPHGFHHF-----GGGGGGEHSF 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 25/64 (39%)
ZUO1 19..>252 CDD:227594 28/97 (29%)
zf-C2H2_jaz 313..337 CDD:288983
C2H2 Zn finger 315..337 CDD:275371
dnj-7NP_509209.1 TPR_11 29..91 CDD:290150
TPR repeat 29..54 CDD:276809
TPR repeat 59..89 CDD:276809
TPR_1 60..93 CDD:278916
TPR_11 61..124 CDD:290150
TPR 77..360 CDD:223533
TPR repeat 94..121 CDD:276809
TPR repeat 140..168 CDD:276809
TPR repeat 173..203 CDD:276809
TPR repeat 208..236 CDD:276809
TPR repeat 324..354 CDD:276809
TPR_1 325..358 CDD:278916
DnaJ 377..>445 CDD:223560 26/66 (39%)
DnaJ 379..444 CDD:278647 25/64 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.