DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and dnj-26

DIOPT Version :9

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_502326.1 Gene:dnj-26 / 178171 WormBaseID:WBGene00001044 Length:365 Species:Caenorhabditis elegans


Alignment Length:320 Identity:60/320 - (18%)
Similarity:111/320 - (34%) Gaps:107/320 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYEELELQRNANDGDIKSAYRKMALRWHPD--KNPDRLAEAKERFQLIQQAYEVLSDPQERSWYD 66
            :|:.|.:.:.|:..:|:.|:||.....|||  |:|    .|.|..:::..|:.:|.||.:|..||
 Worm    28 FYKILNVDKKASPDEIRIAFRKRIREVHPDKCKHP----SATEASKVVNNAFSLLMDPAKRRQYD 88

  Fly    67 NHREQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDKDDRL 131
            .        :|::.:...|          ||....|::...:.|::.            .:.:..
 Worm    89 L--------QNAETSNENL----------YKRCNRNKNQRKQEYSNT------------QRQNHK 123

  Fly   132 GMAPDFGHSNSSYEDVVGPFYAFWQAYSTRKTYDWLCPYDVREIKERFILRKVEKEMKKIVQAAR 196
            ...|..|..|....       :|.|.:::                         |..:...|..:
 Worm   124 KSEPSNGKRNEQNS-------SFKQDHNS-------------------------KNHQSNHQKTK 156

  Fly   197 KERNEEVRNLVNFVRKRDPRVQAYRRM-------------LEERVEAN-RLKQEEKRKEQLRKRQ 247
            .:::....|..||...|    :.||..             .|:.|..| :..|::::.:..|:|.
 Worm   157 NKKSNPYSNQNNFNNTR----KDYREEKSGFSWNTGSADDYEDFVYRNYQSYQQQQQNQYARRRH 217

  Fly   248 EELAAVRKNNVFNEGYEEQLKQLEQQYDSKSEDYTDEDENDDDGEDFDHEGGQEAEEYEV 307
            ||         :.:|:         :|.|.|..::..:|   ...|..|....|.|||.|
 Worm   218 EE---------YTDGF---------KYSSSSNPHSTSNE---PFHDKSHNSDVEKEEYLV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 19/63 (30%)
ZUO1 19..>252 CDD:227594 45/248 (18%)
zf-C2H2_jaz 313..337 CDD:288983
C2H2 Zn finger 315..337 CDD:275371
dnj-26NP_502326.1 DnaJ 27..88 CDD:365959 19/63 (30%)
DUF4887 <81..174 CDD:374444 21/158 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.