DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2790 and dnj-2

DIOPT Version :9

Sequence 1:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_502126.1 Gene:dnj-2 / 178043 WormBaseID:WBGene00001020 Length:337 Species:Caenorhabditis elegans


Alignment Length:311 Identity:70/311 - (22%)
Similarity:116/311 - (37%) Gaps:102/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YEELELQRNANDGD-IKSAYRKMALRWHPD--KNPDRLAEAKERFQLIQQAYEVLSDPQERSWYD 66
            |:.||:.|...|.. :..|||.:|.:.|||  ||.:....|:|||::|..|||.|.|.:.::.||
 Worm    38 YDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNYD 102

  Fly    67 ---NHREQILRGKNSDYAENC----------------LDVFQFFTSSCYKGYGDNEHGF-----Y 107
               :|.:|........|....                :.:|||.::         :|.|     |
 Worm   103 YYLDHPDQRFYNYYQYYRLRAAPKVDLRIVIVGTILIISLFQFLSA---------KHKFSEAIEY 158

  Fly   108 RVYTDVFVQIASED------LEFMDKDDRLGMAPDFGHSNSSY--------EDVVGPFYAFWQAY 158
            ......|..:|.:|      || ||::.:|  ..:.|..|...        .||.|       .|
 Worm   159 ATGVGKFRNMAIKDGIDKGLLE-MDRNGKL--KKNKGVDNDEVIKQIIIDNLDVTG-------GY 213

  Fly   159 STRKTYDWLCPYDV-------REIK------ERFILRKVEKE-------MKKIVQAARKE----- 198
            .....||.|..:.:       |.||      .||.::|.|.:       ::|.:..::.|     
 Worm   214 KRESIYDTLAWHTIIFPLTIFRYIKWTALWYWRFAIQKEEYDDDAKLYLIRKYIGVSQMEFDQKY 278

  Fly   199 RNEEV-----------RNLVNFVRKRDPRVQAYRRMLEERVEANRLKQEEK 238
            .:|::           ||...:..:||...|      |:..::.|.|:.::
 Worm   279 TDEDIDDLFERECWLKRNCATWKAERDAAEQ------EKMAQSGRYKRYKR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 24/63 (38%)
ZUO1 19..>252 CDD:227594 65/296 (22%)
zf-C2H2_jaz 313..337 CDD:288983
C2H2 Zn finger 315..337 CDD:275371
dnj-2NP_502126.1 DnaJ 36..102 CDD:278647 24/63 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.