DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and Tmem211

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_001054448.2 Gene:Tmem211 / 679783 RGDID:1584759 Length:195 Species:Rattus norvegicus


Alignment Length:175 Identity:35/175 - (20%)
Similarity:66/175 - (37%) Gaps:43/175 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRCKVMQEGGF--QCGRF----DLDGLATDSSVY 84
            ::|::|.|...|.            ||.|::|.|...|:..:  .|..|    |:..|       
  Rat    19 LSLISPAWFQSPF------------SSYGVFTYCSWPQDDSWNQSCVTFWSLKDMPTL------- 64

  Fly    85 PNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIHNM--------TACAQVVAGICMMLG 141
              .||.:...::.|:.|||::.:|.       ||...:...:        |...|..|....::|
  Rat    65 --PWKVSAAMLLGGWLLLSLSALLL-------SAWALAPRRLFPRRGFGPTPVVQAAAAASTLVG 120

  Fly   142 LFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIGVLLT 186
            |.:.|....:...:.:| ..:..::...|.:...:...|:.|:||
  Rat   121 LLVFPATLASPFAKEVC-KGSSMYHSGTCWLSWGYAMAILNVVLT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 35/175 (20%)
Tmem211XP_001054448.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342114
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.