Sequence 1: | NP_001286864.1 | Gene: | CG3770 / 37991 | FlyBaseID: | FBgn0035085 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001008653.1 | Gene: | lhfpl6 / 494110 | ZFINID: | ZDB-GENE-041212-82 | Length: | 200 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 51/200 - (25%) |
---|---|---|---|
Similarity: | 82/200 - (41%) | Gaps: | 32/200 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 ITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRCK---------- 60
Fly 61 -VMQEGGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIH 124
Fly 125 NMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIG-----VL 184
Fly 185 LTFTA 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3770 | NP_001286864.1 | L_HGMIC_fpl | 10..195 | CDD:287244 | 48/195 (25%) |
lhfpl6 | NP_001008653.1 | L_HGMIC_fpl | 9..193 | CDD:287244 | 48/195 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170582162 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4026 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |