DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and lhfpl2a

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_991226.1 Gene:lhfpl2a / 402962 ZFINID:ZDB-GENE-040426-1839 Length:225 Species:Danio rerio


Alignment Length:233 Identity:73/233 - (31%)
Similarity:119/233 - (51%) Gaps:24/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCYVIITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQGTD--------STASSHHQSSVGIYT 57
            ||:||:|..|::|.|.|:||.....:|.::..||||..:..|        :.|...::.::|||.
Zfish     1 MCHVIVTCRSMLWTLLSIVAAFSELIAFLSTDWLVGFPRAPDAGFSPLGATAAGEAYRPTLGIYG 65

  Fly    58 RC-KVMQ-EGGFQCGRFDLDGLATDSSVYPNE-----WKAAMFFVMLGFSLLSVTVILTLITCCR 115
            || :|.. ..|..||.:         :|:..|     |:|...|:..|..||.....:::.|.|.
Zfish    66 RCIRVPHYRRGVLCGPY---------AVHFGEIASGFWQATAIFLAAGILLLCAVAFISIFTMCF 121

  Fly   116 QSACGKSIHNMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGI 180
            ||...|||.|:....|.:||:.:::||.|:|.||.:.::|..||.|:.|:....||.|.:||..:
Zfish   122 QSIMKKSIFNVCGLLQAIAGLFLIVGLVLYPAGWGSQKVQLYCGPDSSPYRLGLCSAGWAFYTAL 186

  Fly   181 IGVLLTFTAAGISLKAESSNMRTRVRRRVEAGSKLVCI 218
            .|.:|.|..|..|.:||.:....:|:..::.|..|:|:
Zfish   187 AGTVLCFLCAVFSAQAEIATSSDKVQEEIQEGKSLICL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 62/199 (31%)
lhfpl2aNP_991226.1 L_HMGIC_fpl 9..201 CDD:287244 62/200 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582159
Domainoid 1 1.000 123 1.000 Domainoid score I5530
eggNOG 1 0.900 - - E1_KOG4026
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4330
OMA 1 1.010 - - QHG49708
OrthoDB 1 1.010 - - D1431349at2759
OrthoFinder 1 1.000 - - FOG0006026
OrthoInspector 1 1.000 - - otm26549
orthoMCL 1 0.900 - - OOG6_109429
Panther 1 1.100 - - LDO PTHR12489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5780
SonicParanoid 1 1.000 - - X4322
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.