DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and Tmhs

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_647674.1 Gene:Tmhs / 38251 FlyBaseID:FBgn0262624 Length:265 Species:Drosophila melanogaster


Alignment Length:185 Identity:45/185 - (24%)
Similarity:70/185 - (37%) Gaps:35/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCYVIITIASLVWFLCSLVADMLFAVALVTPRWLVGP-AQGTDSTASSHHQSSVGIYTRCKVMQE 64
            :||.||.|                 ||.|||.|:..| ..|..............|:..|:...|
  Fly    34 ICYAIIGI-----------------VAFVTPEWIGDPDNDGAGRLGLWQQCQRDEIFDNCRRRWE 81

  Fly    65 GGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIHNMTAC 129
            ..|:...|... |||              |.|||...|::..|..|:  |........:.::...
  Fly    82 SIFEVPTFSFQ-LAT--------------FFMLGAIALALLTIFFLV--CLLFMKSTRVFHLCGW 129

  Fly   130 AQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIGVL 184
            .|:::.|||::.....|.||.::..:::||.:|..|....|.|..::...|||.:
  Fly   130 MQIISAICMIVACAAFPFGWNSDDFRKICGPEANRFELGLCGIRWAYPLAIIGCI 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 40/176 (23%)
TmhsNP_647674.1 L_HGMIC_fpl 25..199 CDD:287244 45/185 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4026
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12489
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.