DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and Lhfpl1

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_851599.1 Gene:Lhfpl1 / 300286 RGDID:727927 Length:220 Species:Rattus norvegicus


Alignment Length:196 Identity:44/196 - (22%)
Similarity:80/196 - (40%) Gaps:29/196 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRCK---------- 60
            :|:....|...|||..:..:.:...|.||.|...|...:.|:        :.||.          
  Rat     5 LTLVGTFWAFLSLVTAVASSTSYFLPYWLFGSQLGKPVSFST--------FRRCNYPVRGDGHNL 61

  Fly    61 VMQEGGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIHN 125
            :|.|   :|||:     |:.:::....|:........|.:||.:..:..::.||.:....:.:..
  Rat    62 IMVE---ECGRY-----ASFAAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGR 118

  Fly   126 MTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYC---GIIGVLLTF 187
            ....||.|.|:.:..|..|:|:||.:..:.:.||..:..|....|.:|.::||   |....:|..
  Rat   119 CMGAAQFVGGLLISSGCALYPLGWNSPEVMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAMLIC 183

  Fly   188 T 188
            |
  Rat   184 T 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 43/192 (22%)
Lhfpl1NP_851599.1 L_HMGIC_fpl 8..192 CDD:370913 43/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.