DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and TMEM211

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001375128.1 Gene:TMEM211 / 255349 HGNCID:33725 Length:200 Species:Homo sapiens


Alignment Length:230 Identity:52/230 - (22%)
Similarity:83/230 - (36%) Gaps:56/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRCKVMQEGGF--QCGRF 72
            |.||....|......|.:|::|.|...|.            .|.||.|.|...|...:  .|..|
Human     3 SSVWVALGLSLTCTSAFSLISPAWFQTPT------------FSFGILTYCSWPQGNSWNQSCVTF 55

  Fly    73 ----DLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLI-------TCCRQSAC---GKSI 123
                |:...|         ||.:...::.|:.||:...|..|.       .|.|:|:.   |   
Human    56 SSLEDIPDFA---------WKVSAVMLLGGWLLLAFNAIFLLSWAVAPKGLCPRRSSVPMPG--- 108

  Fly   124 HNMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIGVLLTFT 188
                  .|.||...|::||.:.|:|..:..|:.:|.. :..:|...|.:|..:...|:..:|...
Human   109 ------VQAVAATAMIVGLLIFPIGLASPFIKEVCEA-SSMYYGGKCRLGWGYMTAILNAVLASL 166

  Fly   189 AAGISLKAESSNMRTRVRRRV----EAGSKLVCIP 219
            ...||..     ..|:|:.|.    .|..:::.:|
Human   167 LPIISWP-----HTTKVQGRTIIFSSATERIIFVP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 47/200 (24%)
TMEM211NP_001375128.1 PMP22_Claudin 3..167 CDD:419754 45/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148233
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.