DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and LHFPL5

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_872354.1 Gene:LHFPL5 / 222662 HGNCID:21253 Length:219 Species:Homo sapiens


Alignment Length:191 Identity:43/191 - (22%)
Similarity:86/191 - (45%) Gaps:33/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRC-------KVMQEGGFQ 68
            ::|...::...:|.....:.|.| :|.:..|...      ...|:::.|       :::.:||  
Human    27 VMWGTLTICFSVLVMALFIQPYW-IGDSVNTPQA------GYFGLFSYCVGNVLSSELICKGG-- 82

  Fly    69 CGRFDLDGLATDSSVYPNEWKAAMFFVMLG-FSLLSVTVILTLITCCRQSACGKSIHNMTACAQV 132
                .||    .||:....:|.|||||.|| |.::...:..:|...|..:    :::.:.|..|:
Human    83 ----PLD----FSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTA----TVYKICAWMQL 135

  Fly   133 VAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIGV----LLTFTA 189
            .|...:|:|..::|.||.::.::|:||.....:....|:|..:|...|:.:    :|:|.|
Human   136 AAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 43/191 (23%)
LHFPL5NP_872354.1 L_HMGIC_fpl 25..202 CDD:370913 43/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.