DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and Lhfpl2

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_766177.1 Gene:Lhfpl2 / 218454 MGIID:2145236 Length:222 Species:Mus musculus


Alignment Length:226 Identity:76/226 - (33%)
Similarity:114/226 - (50%) Gaps:13/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCYVIITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQ-----GTDSTASSHHQSSVGIY-TRC 59
            ||:||:|..|::|.|.|:|......||.::..||:|.|:     |.:....:.....:||. .|.
Mouse     1 MCHVIVTCRSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGSGDEQAGMNSEPHYLGILCIRT 65

  Fly    60 KVMQEGGFQCGRFDLDGLATDS--SVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKS 122
            ..||    |..|..|.|....|  .:....|:|...|:.:|..:|.|..::::.|.|.||...||
Mouse    66 PAMQ----QVSRDTLCGTYAKSFGEIASGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKS 126

  Fly   123 IHNMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIGVLLTF 187
            |.|:....|.:||:.::|||.|:|.||...:... ||..|.|:.|.|||:|.:||....|.:|||
Mouse   127 IFNVCGLLQGIAGLFLILGLILYPAGWGCQKAID-CGRYASPYKPGDCSLGWAFYTATGGTVLTF 190

  Fly   188 TAAGISLKAESSNMRTRVRRRVEAGSKLVCI 218
            ..|..|.:||.:....:|:..:|.|..|||:
Mouse   191 ICAVFSAQAEIATSSDKVQEEIEEGKNLVCL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 63/192 (33%)
Lhfpl2NP_766177.1 PMP22_Claudin 9..198 CDD:419754 63/193 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838323
Domainoid 1 1.000 96 1.000 Domainoid score I7338
eggNOG 1 0.900 - - E1_KOG4026
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4694
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49708
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006026
OrthoInspector 1 1.000 - - oto93422
orthoMCL 1 0.900 - - OOG6_109429
Panther 1 1.100 - - LDO PTHR12489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5780
SonicParanoid 1 1.000 - - X4322
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.