DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and LHFPL6

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_005771.1 Gene:LHFPL6 / 10186 HGNCID:6586 Length:200 Species:Homo sapiens


Alignment Length:186 Identity:43/186 - (23%)
Similarity:78/186 - (41%) Gaps:8/186 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRCKVMQEGGFQCG 70
            :|...::|.|.|.:......|....|.||.|...|...:..:..:.|..::...:.|.....:||
Human     5 LTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECG 69

  Fly    71 RFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIHNMTACAQVVAG 135
            |:     |:...:...||:.......||..||.:..:..|:.||......:::..:....|.:.|
Human    70 RY-----ASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGG 129

  Fly   136 ICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYC---GIIGVLLTFT 188
            :.:..|..|:|:||.:..:::.||..:..|....|.||.::||   |....:|..|
Human   130 LLIGAGCALYPLGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCT 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 42/182 (23%)
LHFPL6NP_005771.1 L_HMGIC_fpl 8..193 CDD:370913 42/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148234
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.