Sequence 1: | NP_001286864.1 | Gene: | CG3770 / 37991 | FlyBaseID: | FBgn0035085 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021321979.1 | Gene: | LOC100334706 / 100334706 | -ID: | - | Length: | 200 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 49/197 - (24%) |
---|---|---|---|
Similarity: | 80/197 - (40%) | Gaps: | 30/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 ITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRCK---------- 60
Fly 61 -VMQEGGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIH 124
Fly 125 NMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYC---GIIGVLLT 186
Fly 187 FT 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3770 | NP_001286864.1 | L_HGMIC_fpl | 10..195 | CDD:287244 | 48/193 (25%) |
LOC100334706 | XP_021321979.1 | PMP22_Claudin | 8..193 | CDD:328820 | 48/194 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |