DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and LOC100334706

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_021321979.1 Gene:LOC100334706 / 100334706 -ID:- Length:200 Species:Danio rerio


Alignment Length:197 Identity:49/197 - (24%)
Similarity:80/197 - (40%) Gaps:30/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRCK---------- 60
            :|...::|.|.||::.....|....|.||:|        :......|.|.:.||.          
Zfish     5 LTCTGVIWALVSLLSAAASCVGFFMPYWLLG--------SQMDKAVSFGTFRRCSYPVRDEERQA 61

  Fly    61 -VMQEGGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSACGKSIH 124
             ||.|   ||||:     |:...:...||:.......:|..||.:..:..|:.||......:||.
Zfish    62 TVMLE---QCGRY-----ASFQGIPSVEWRICTVITGVGCGLLLLVGLTALMGCCISELISRSIG 118

  Fly   125 NMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYC---GIIGVLLT 186
            ......|.:.|:.:..|..|:|:||.:..:::.|...::.|....|.||.::||   |....:|.
Zfish   119 RAAGGIQFLGGLLIGSGCALYPLGWDSEEVRQTCNNSSDQFELGSCQIGWAYYCTGAGAASAMLL 183

  Fly   187 FT 188
            .|
Zfish   184 CT 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 48/193 (25%)
LOC100334706XP_021321979.1 PMP22_Claudin 8..193 CDD:328820 48/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.