DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3770 and lhfpl3

DIOPT Version :9

Sequence 1:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_031753495.1 Gene:lhfpl3 / 100145306 XenbaseID:XB-GENE-6033769 Length:245 Species:Xenopus tropicalis


Alignment Length:216 Identity:53/216 - (24%)
Similarity:98/216 - (45%) Gaps:26/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHHQSSVGIYTRCKVMQEGGFQCGRFDLD 75
            ::|.:.::...::..|..:.|.|:   ..|.|:..:.:    .|::..|   ...||. ......
 Frog    31 VLWAIFTICFAIVNIVCFIQPYWI---GDGVDTPQAGY----FGLFHYC---IGSGFS-KELTCT 84

  Fly    76 GLATD-SSVYPNEWKAAMFFVMLGFSL-LSVTVILTLITCCRQSACGKSIHNMTACAQVVAGICM 138
            |..|| ||:....:|||.||:.|..:| :...|...|...|..:    :::.:.|..|:.:..|:
 Frog    85 GSFTDFSSIPSGAFKAASFFIGLSMTLIIGCIVSFGLFFFCNTA----TVYKICAWMQLCSAACL 145

  Fly   139 MLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGIIGVL----LTFTAAGI-----SL 194
            :||..:.|.||.|:.::|:||...:.:....||:..::...|||:|    |:|.|..:     ||
 Frog   146 VLGCMIFPDGWDADEVKRMCGEKTDKYSLGACSVRWAYILAIIGILDALILSFLAFVLGNRLDSL 210

  Fly   195 KAESSNMRTRVRRRVEAGSKL 215
            .||...:.::...|..:|..|
 Frog   211 MAEQLKLESKESARHPSGQNL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 47/194 (24%)
lhfpl3XP_031753495.1 L_HMGIC_fpl 29..206 CDD:370913 46/189 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.