DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and MEGF10

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_016865476.1 Gene:MEGF10 / 84466 HGNCID:29634 Length:1195 Species:Homo sapiens


Alignment Length:214 Identity:55/214 - (25%)
Similarity:70/214 - (32%) Gaps:90/214 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CNIV--CLN-GVCFE-DGSCPCADQYMAGNPD--------GLVCAAEC----LPGCVAAGGYCAA 101
            ||:.  ||| |.|.. ||:|.||..:.....:        ||.||..|    ..||....|:|. 
Human   550 CNLTCQCLNGGACNTLDGTCTCAPGWRGEKCELPCQDGTYGLNCAERCDCSHADGCHPTTGHCR- 613

  Fly   102 PDLC-----------VCREDRHYYFDPLSQKCRHRAPRLLDPCLGRCTHG-NCS-SDGRCICAQG 153
               |           ||.|.|.             .|....||.  |.:| :|| .||.|.||.|
Human   614 ---CLPGWSGVHCDSVCAEGRW-------------GPNCSLPCY--CKNGASCSPDDGICECAPG 660

  Fly   154 Y------ELRDSLLHGQQC---MPICDHNCGP---------------RAYC--------FAPN-- 184
            :      .:.....:|.:|   .|.|.|:.||               .|.|        |..|  
Human   661 FRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVCPSGRFGKNCA 725

  Fly   185 -LCACRHKQHHYAHNGICS 202
             :|.|       .:||.|:
Human   726 GICTC-------TNNGTCN 737



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.