DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and dkk1a

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001268729.2 Gene:dkk1a / 799377 ZFINID:ZDB-GENE-090313-406 Length:247 Species:Danio rerio


Alignment Length:200 Identity:44/200 - (22%)
Similarity:69/200 - (34%) Gaps:86/200 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QLCSDYEMLVVNTRQCVRRC--------NIVCLNGVC---------FEDGSCPCADQYMAG---- 77
            :.|:....:.::.|:..:||        ...|:||||         ..|.|.|..:..::|    
Zfish    78 EFCNGSRGVCLSCRKRRKRCARDGMCCAGNRCINGVCQLADAAAVGSADASPPGGNTDVSGVAVT 142

  Fly    78 ------NP----------------DGLVC--AAECLPGCVAAGGYCAAPDLCVCREDRHYYFDPL 118
                  :|                :|..|  :::||.|            ||..   ||::    
Zfish   143 RGQNFTHPRRTTVLSKPQQTQKGGEGETCLRSSDCLEG------------LCCA---RHFW---- 188

  Fly   119 SQKCRHRAPRLLDPCLGR-CT-HGNCSSDG-----RCICAQGYELRDSLLHGQQCMPICD----H 172
            |:.|:   |.|.:   |: || |....:.|     ||.|..|...|     ||:..|..:    |
Zfish   189 SRICK---PVLTE---GQVCTRHRRKGAHGLEIFQRCDCGSGLTCR-----GQREKPGAESRNLH 242

  Fly   173 NCGPR 177
            .|.||
Zfish   243 TCQPR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
dkk1aNP_001268729.2 Dickkopf_N 68..115 CDD:282549 8/36 (22%)
COLIPASE 167..236 CDD:305210 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.