DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and Pear1

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001027585.1 Gene:Pear1 / 73182 MGIID:1920432 Length:1034 Species:Mus musculus


Alignment Length:261 Identity:59/261 - (22%)
Similarity:73/261 - (27%) Gaps:115/261 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QLCSDYEMLVVNTRQCVRRCNIVCLNGVCFEDGSCPCADQYMAGNPDGLVCAAECLPG------- 91
            |.|..|   ..:...||..|...|::|.|.....|.||..:..|:     |::||.||       
Mouse    87 QCCRGY---YESRGACVPLCAQECVHGRCVAPNQCQCAPGWRGGD-----CSSECAPGMWGPQCD 143

  Fly    92 ----------CVAAGGYCAAPD-----LCV-----------CREDRHYY---FDPLSQKC----R 123
                      |....|.|..|.     .|:           |:.|...|   .||....|    .
Mouse   144 KFCHCGNNSSCDPKSGTCFCPSGLQPPNCLQPCPAGHYGPACQFDCQCYGASCDPQDGACFCPPG 208

  Fly   124 HRAPRLLDPC------------------------LGRCT------------------HG-NCSSD 145
            ...|....||                        .|.|:                  || ||:.:
Mouse   209 RAGPSCNVPCSQGTDGFFCPRTYPCQNGGVPQGSQGSCSCPPGWMGVICSLPCPEGFHGPNCTQE 273

  Fly   146 -------------GRCICAQGYELRDSLLH-------GQQCMPICDHNCGPRAYCFAPN-LCACR 189
                         |:|.||.|| :.|....       ||.|...||  |.|.|.||..| .|.|.
Mouse   274 CRCHNGGLCDRFTGQCHCAPGY-IGDRCQEECPVGRFGQDCAETCD--CAPGARCFPANGACLCE 335

  Fly   190 H 190
            |
Mouse   336 H 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
Pear1NP_001027585.1 EMI 25..93 CDD:284877 3/8 (38%)
EGF_CA 535..580 CDD:304395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 823..883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 925..1034
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.