DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and tnfaip6

DIOPT Version :10

Sequence 1:NP_611984.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:93 Identity:26/93 - (27%)
Similarity:38/93 - (40%) Gaps:21/93 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VC-FEDGSCPCADQYMAGNPDGL-VCAAECLP------GCVAAGGYCAAPDLCVC-------RED 110
            || ||.|:....||..|....|. ||||..|.      ..|.||..|....:.:.       :.:
Zfish    67 VCNFEGGTLATFDQLEAARQIGFHVCAAGWLDKGRVGYPIVKAGSNCGFGKVGIIDYGYRLNKSE 131

  Fly   111 RH--YYFDPLSQKCR--HRAPR--LLDP 132
            |.  |.::|::::|.  |..|.  |:.|
Zfish   132 RWDVYCYNPVAKECGGVHTDPEKVLVSP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_611984.1 None
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 20/70 (29%)
CUB 145..254 CDD:395345 5/15 (33%)

Return to query results.
Submit another query.