Sequence 1: | NP_001286863.1 | Gene: | CG15861 / 37990 | FlyBaseID: | FBgn0035084 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009304569.1 | Gene: | megf6b / 557764 | ZFINID: | ZDB-GENE-101112-3 | Length: | 1589 | Species: | Danio rerio |
Alignment Length: | 236 | Identity: | 60/236 - (25%) |
---|---|---|---|
Similarity: | 76/236 - (32%) | Gaps: | 87/236 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 EINEPSQLCSDYEMLVVNTRQCVRRCNIVCLNGVCFEDGSCPCADQYMAG---NPDGLVCAAECL 89
Fly 90 PGCVAAGGYC--------AAPDLCVCREDRHYYFDP-----------------LSQKCR------ 123
Fly 124 ----HRAPRL---------LDPC-LGR--CTHG--NCSSDGRCICAQGYELRDSLLHGQQCMPI- 169
Fly 170 ------CDHNCGPRAYCFAPNLCACRHKQHHYAHNGICSGN 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15861 | NP_001286863.1 | None | |||
megf6b | XP_009304569.1 | EMI | 33..102 | CDD:284877 | |
FXa_inhibition | 152..187 | CDD:291342 | 2/7 (29%) | ||
vWFA | <184..227 | CDD:294047 | 14/52 (27%) | ||
FXa_inhibition | 234..270 | CDD:291342 | 10/37 (27%) | ||
FXa_inhibition | 276..311 | CDD:291342 | 5/34 (15%) | ||
vWFA | <308..350 | CDD:294047 | 13/44 (30%) | ||
FXa_inhibition | 363..398 | CDD:291342 | 10/35 (29%) | ||
vWFA | <396..436 | CDD:294047 | |||
FXa_inhibition | 445..480 | CDD:291342 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |