DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and megf6b

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_009304569.1 Gene:megf6b / 557764 ZFINID:ZDB-GENE-101112-3 Length:1589 Species:Danio rerio


Alignment Length:236 Identity:60/236 - (25%)
Similarity:76/236 - (32%) Gaps:87/236 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EINEPSQLCSDYEMLVVNTRQCVRRCNIVCLNGVCFEDGSCPCADQYMAG---NPDGLVCAAECL 89
            |:.|..:.|.|.:...|:...|..    .|:|    ..||..|  |..||   :.||..|.|  :
Zfish   179 ELKEDGKTCQDIDECQVHNGGCQH----TCVN----TRGSYHC--QCNAGSRLHVDGRTCIA--V 231

  Fly    90 PGCVAAGGYC--------AAPDLCVCREDRHYYFDP-----------------LSQKCR------ 123
            ..|....|.|        |....|.||.|  |..|.                 .||.|.      
Zfish   232 QSCGVGNGGCEHFCVQQTAGHVQCRCRPD--YRLDADGKHCTLVNPCAEQNGGCSQMCHRDGAQA 294

  Fly   124 ----HRAPRL---------LDPC-LGR--CTHG--NCSSDGRCICAQGYELRDSLLHGQQCMPI- 169
                |...:|         :|.| ||:  |.||  |......|:|:..|||.   :.|:||..| 
Zfish   295 RCECHPGYQLAEDGKTCEDIDECALGQTDCAHGCRNTRGSFMCVCSAAYELG---VDGKQCYRIE 356

  Fly   170 ------CDHNCGPRAYCFAPNLCACRHKQHHYAHNGICSGN 204
                  |||:.|           .|.|...|.....:||.|
Zfish   357 MEIVNSCDHDNG-----------GCSHHCEHSTAGPLCSCN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
megf6bXP_009304569.1 EMI 33..102 CDD:284877
FXa_inhibition 152..187 CDD:291342 2/7 (29%)
vWFA <184..227 CDD:294047 14/52 (27%)
FXa_inhibition 234..270 CDD:291342 10/37 (27%)
FXa_inhibition 276..311 CDD:291342 5/34 (15%)
vWFA <308..350 CDD:294047 13/44 (30%)
FXa_inhibition 363..398 CDD:291342 10/35 (29%)
vWFA <396..436 CDD:294047
FXa_inhibition 445..480 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.