DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and NimC1

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster


Alignment Length:224 Identity:64/224 - (28%)
Similarity:79/224 - (35%) Gaps:87/224 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NTRQCVR-----------------RCNIVCL----NGVCFEDGSCPCADQYMAGN---------- 78
            |:| |||                 .|..||.    ||:|...|.|.|...|:..|          
  Fly   219 NSR-CVRPGVCECENGYAGDDGGTNCRPVCSTCPENGLCLSPGVCVCKPGYVMRNDLCQPHCEKC 282

  Fly    79 PDGLVCAA----ECLPGCVAAG---------------GYCAAPDLCVCREDRHYYFDPLSQKCRH 124
            .|...|.|    ||.||..::|               |:|.||:.|||  ...|...| :|.|..
  Fly   283 SDNAHCVAPNQCECFPGYESSGADKKCVPKCSKGCTNGFCFAPETCVC--SIGYQMGP-NQVCEP 344

  Fly   125 RAPRLLDPCLGRCTHGNCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCFAPNLCACR 189
            :       |...|.||.|:|...|.|..||..:|:..|  :|.||||..|. ..:|.|||.|.| 
  Fly   345 K-------CSLNCVHGKCTSPETCTCDPGYRFKDNSHH--ECDPICDSGCS-NGHCVAPNFCIC- 398

  Fly   190 HKQHHYAHNG---------------ICSG 203
                   |:|               ||.|
  Fly   399 -------HDGYQLNSTNPVTSMCQPICKG 420



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.