DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and NimB4

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:221 Identity:58/221 - (26%)
Similarity:82/221 - (37%) Gaps:59/221 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YGYWEINEPSQLCSDYEMLVVNTRQCVRRCNIVC-LNGVCFEDGSCPCADQYMAG---------- 77
            :|...:|...|....|| |..:.:.|..:||..| .|.||.|.|.|.||:.|..|          
  Fly   183 HGRCYLNGTCQCDKGYE-LDGSRKFCQPQCNATCGHNEVCLEPGKCSCAEGYTRGLRESAALGCQ 246

  Fly    78 ---NPD-----------------------GLVCAAECLPGCVAAGGYCAAPDLCVCREDRHYYFD 116
               .||                       |:.|..:|...|  ..|:||....|||:..  |.:|
  Fly   247 PICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTC--ENGFCANKTTCVCQNG--YRYD 307

  Fly   117 PLSQKCRHRAPRLLDPCLGRCTHGNCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCF 181
            ..:..|       |..|...|.:|.|.|.|.|.|.:||     :.:.::|..:|...||....|.
  Fly   308 KNTTTC-------LPDCGDNCDNGVCISPGNCRCFKGY-----VRNRERCEAVCVGGCGFYGKCI 360

  Fly   182 APNLCACR-----HKQHHYAHNGICS 202
            |||:|.|.     .:.:.....|:|:
  Fly   361 APNVCGCAIVPGPERTYQRCEYGLCN 386



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 1 1.000 - - FOG0014295
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.