DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and CG11674

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:172 Identity:38/172 - (22%)
Similarity:58/172 - (33%) Gaps:55/172 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NGVCFED-GSCPCADQYMAGNPDGLVCAAECLPGCVAAGGYCAAPDLCVCREDRHYYFDPLSQKC 122
            |.:|... ..|.|::.:::.:.     ...|||..|..||.|.....|. |.||  :...:..:|
  Fly    84 NAICHTRWQQCHCSEGHVSSDD-----RRRCLPAVVPVGGSCEFQQQCQ-RADR--FSSCIGNQC 140

  Fly   123 RHRAPRLLDPCL-------GRCTH------------GNCSSD------GRCICAQGYELRDSL-- 160
            .         ||       |||..            |:|.:.      .||.|::.:....::  
  Fly   141 L---------CLNQFEFHEGRCLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNMTK 196

  Fly   161 -LHGQQCMPICDH------NCGPRAYCFAPNLCACRHKQHHY 195
             :.|......|:|      |.|....|. .:||.||  ..||
  Fly   197 CIKGSAYGDTCEHSSPCKLNLGADGRCL-DHLCVCR--STHY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
CG11674NP_572948.1 EB 96..153 CDD:279949 16/73 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.